SCOPe 2.08: Domain d2axoa1: 2axo A:38-262

Lineage for d2axoa1 (2axo A:38-262)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.19: Atu2684-like [142398] (1 protein)
   Pfam PF06764; DUF1223; contains extra C-terminal domain of Immunoglobulin-like fold (48725), intimately associated with the N-terminal thioredixin-like domain and contributing to the active site

6. Protein Hypothetical protein Atu2684 [142399] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [142400] (1 PDB entry)
   Uniprot Q8UC14 38-262

8. Domain d2axoa1: 2axo A:38-262 [127496]
   Other proteins in same PDB: d2axoa2

Details for d2axoa1

PDB Entry: 2axo, 1.8 Å

PDB Description: X-Ray Crystal Structure of Protein AGR_C_4864 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR35.

PDB Compounds: (A:) hypothetical protein Atu2684

SCOPe Domain Sequences for d2axoa1:

Sequence, based on SEQRES records:

>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]}
aqeavkgvvelftsqgcascppadealrkmiqkgdvvglsyhvdywnylgwtdslasken
terqygymralgrngvytpqailngrdhvkgadvrgiydrldafkregqglnvpvsskfa
gdeveidigagngkadvvvayftreqtvdvqkgenqgkkmsywhsvydvqtvgmwdgspm
tvklpasvvakvkkggcavllqtanasgdpaaivgasillgnetq

Sequence, based on observed residues (ATOM records):

>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]}
aqeavkgvvelftsqgcascppadealrkmiqkgdvvglsyhvdywnylgwtdslasken
terqygymralgrngvytpqailngrdhvkgadvrgiydrldafkregqglnvpvsskfa
gdeveidigagngkadvvvayftreqtvdvkkmsywhsvydvqtvgmwdgspmtvklpas
vvakvkkggcavllqtanasgdpaaivgasillgnetq

Timeline for d2axoa1:

• d2axoa1 first appeared in SCOP 1.73
  
• d2axoa1 appears in SCOPe 2.07