Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (3 proteins) follows the tandem AAA-ATPase domain |
Protein Werner syndrome ATP-dependent helicase WRN [140263] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140264] (1 PDB entry) Uniprot Q14191 949-1092 |
Domain d2axla1: 2axl A:1-144 [127495] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2axl (more details)
SCOPe Domain Sequences for d2axla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} mddsedtswdfgpqafkllsavdilgekfgiglpilflrgsnsqrladqyrrhslfgtgk dqteswwkafsrqlitegflvevsrynkfmkicaltkkgrnwlhkantesqslilqanee lcpkklllpssktvssgtkehcyn
Timeline for d2axla1: