Lineage for d2axia1 (2axi A:25-109)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325522Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2325523Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2325524Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2325531Protein MDM2 [47594] (2 species)
  7. 2325549Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2325561Domain d2axia1: 2axi A:25-109 [127494]
    automatically matched to d1ycra_
    complexed with mpo, so4

Details for d2axia1

PDB Entry: 2axi (more details), 1.4 Å

PDB Description: hdm2 in complex with a beta-hairpin
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d2axia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axia1 a.42.1.1 (A:25-109) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOPe Domain Coordinates for d2axia1:

Click to download the PDB-style file with coordinates for d2axia1.
(The format of our PDB-style files is described here.)

Timeline for d2axia1: