| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
| Protein MDM2 [47594] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries) |
| Domain d2axia1: 2axi A:25-109 [127494] automatically matched to d1ycra_ complexed with mpo, so4 |
PDB Entry: 2axi (more details), 1.4 Å
SCOPe Domain Sequences for d2axia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axia1 a.42.1.1 (A:25-109) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv
Timeline for d2axia1: