SCOP 1.73: Domain d2axhb1: 2axh B:5-118

Lineage for d2axhb1 (2axh B:5-118)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (16 PDB entries)

8. Domain d2axhb1: 2axh B:5-118 [127492]
   Other proteins in same PDB: d2axha2, d2axhb2
   automatically matched to d1ogae1
   mutant

Details for d2axhb1

PDB Entry: 2axh, 2.7 Å

PDB Description: Crystal structures of T cell receptor beta chains related to rheumatoid arthritis

PDB Compounds: (B:) T cell receptor beta chain

SCOP Domain Sequences for d2axhb1:

Sequence; same for both SEQRES and ATOM records:

>d2axhb1 b.1.1.1 (B:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcassigqmneqyfgpgtrltvledlk

Timeline for d2axhb1:

• d2axhb1 is new in SCOP 1.73
  
• d2axhb1 appears in SCOP 1.75
  
• d2axhb1 appears in the current release, SCOPe 2.08