SCOPe 2.07: Domain d2axha1: 2axh A:3-115

Lineage for d2axha1 (2axh A:3-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2axha1: 2axh A:3-115 [127490]
   automated match to d2axja1

Details for d2axha1

PDB Entry: 2axh, 2.7 Å

PDB Description: Crystal structures of T cell receptor beta chains related to rheumatoid arthritis

PDB Compounds: (A:) T cell receptor beta chain

SCOPe Domain Sequences for d2axha1:

Sequence; same for both SEQRES and ATOM records:

>d2axha1 b.1.1.0 (A:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dggitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdi
aegysvsrekkesfpltvtsaqknptafylcassigqmneqyfgpgtrltvle

Timeline for d2axha1:

• d2axha1 first appeared in SCOP 1.73
  
• d2axha1 appears in SCOPe 2.06
  
• d2axha1 appears in the current release, SCOPe 2.08