Lineage for d2axha1 (2axh A:5-118)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653994Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 654006Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (16 PDB entries)
  8. 654015Domain d2axha1: 2axh A:5-118 [127490]
    Other proteins in same PDB: d2axha2, d2axhb2
    automatically matched to d1ogae1
    mutant

Details for d2axha1

PDB Entry: 2axh (more details), 2.7 Å

PDB Description: Crystal structures of T cell receptor beta chains related to rheumatoid arthritis
PDB Compounds: (A:) T cell receptor beta chain

SCOP Domain Sequences for d2axha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axha1 b.1.1.1 (A:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcassigqmneqyfgpgtrltvledlk

SCOP Domain Coordinates for d2axha1:

Click to download the PDB-style file with coordinates for d2axha1.
(The format of our PDB-style files is described here.)

Timeline for d2axha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2axha2