Lineage for d2axfa2 (2axf A:1-181)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856493Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (25 PDB entries)
  8. 856506Domain d2axfa2: 2axf A:1-181 [127485]
    Other proteins in same PDB: d2axfa1, d2axfb1
    automatically matched to d1a1ma2
    complexed with acy

Details for d2axfa2

PDB Entry: 2axf (more details), 1.8 Å

PDB Description: the immunogenicity of a viral cytotoxic t cell epitope is controlled by its mhc-bound conformation
PDB Compounds: (A:) HLA class I histocompatibility antigen, B*3508 heavy chain

SCOP Domain Sequences for d2axfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axfa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq
r

SCOP Domain Coordinates for d2axfa2:

Click to download the PDB-style file with coordinates for d2axfa2.
(The format of our PDB-style files is described here.)

Timeline for d2axfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2axfa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2axfb1