SCOPe 2.04: Domain d2axds_: 2axd S:

Lineage for d2axds_ (2axd S:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Theta subunit of DNA polymerase III [46577] (1 species)

7. Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)

8. Domain d2axds_: 2axd S: [127483]
   automated match to d2axds1
   protein/DNA complex

Details for d2axds_

PDB Entry: 2axd

PDB Description: solution structure of the theta subunit of escherichia coli dna polymerase iii in complex with the epsilon subunit

PDB Compounds: (S:) DNA polymerase III, theta subunit

SCOPe Domain Sequences for d2axds_:

Sequence; same for both SEQRES and ATOM records:

>d2axds_ a.237.1.1 (S:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

Timeline for d2axds_:

• d2axds_ first appeared in SCOP 1.73, called d2axds1
  
• d2axds_ was called d2axds1 in SCOPe 2.03
  
• d2axds_ appears in SCOPe 2.05
  
• d2axds_ appears in the current release, SCOPe 2.08