Lineage for d2axds1 (2axd S:1-76)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286445Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 1286446Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 1286447Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 1286453Protein Theta subunit of DNA polymerase III [46577] (1 species)
  7. 1286454Species Escherichia coli [TaxId:562] [46578] (3 PDB entries)
  8. 1286456Domain d2axds1: 2axd S:1-76 [127483]
    automatically matched to d1du2a_
    protein/DNA complex

Details for d2axds1

PDB Entry: 2axd (more details)

PDB Description: solution structure of the theta subunit of escherichia coli dna polymerase iii in complex with the epsilon subunit
PDB Compounds: (S:) DNA polymerase III, theta subunit

SCOPe Domain Sequences for d2axds1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axds1 a.237.1.1 (S:1-76) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

SCOPe Domain Coordinates for d2axds1:

Click to download the PDB-style file with coordinates for d2axds1.
(The format of our PDB-style files is described here.)

Timeline for d2axds1: