![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) ![]() automatically mapped to Pfam PF06440 |
![]() | Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins) Pfam PF06440 independent solution structure determinations of different members resulted in similar secondary structures but different folds |
![]() | Protein Theta subunit of DNA polymerase III [46577] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46578] (3 PDB entries) |
![]() | Domain d2axds1: 2axd S:1-76 [127483] automatically matched to d1du2a_ protein/DNA complex |
PDB Entry: 2axd (more details)
SCOPe Domain Sequences for d2axds1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axds1 a.237.1.1 (S:1-76) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr lasvnlsrlpyepklk
Timeline for d2axds1: