Lineage for d2ax7a_ (2ax7 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Androgen receptor [63621] (4 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. Domain d2ax7a_: 2ax7 A: [127480]
    automated match to d1e3ga_
    complexed with fhm; mutant

Details for d2ax7a_

PDB Entry: 2ax7 (more details), 1.9 Å

PDB Description: crystal structure of the androgen receptor ligand binding domain t877a mutant in complex with s-1
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2ax7a_:

Sequence, based on SEQRES records: (download)

>d2ax7a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfh

Sequence, based on observed residues (ATOM records): (download)

>d2ax7a_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiacsrrfyql
tklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyfh

SCOPe Domain Coordinates for d2ax7a_ are not available.

Timeline for d2ax7a_: