Lineage for d2ax6a1 (2ax6 A:672-917)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647847Protein Androgen receptor [63621] (3 species)
  7. 647873Species Rat (Rattus norvegicus) [TaxId:10116] [63622] (7 PDB entries)
  8. 647874Domain d2ax6a1: 2ax6 A:672-917 [127479]
    automatically matched to d1i38a_
    complexed with hft; mutant

Details for d2ax6a1

PDB Entry: 2ax6 (more details), 1.5 Å

PDB Description: crystal structure of the androgen receptor ligand binding domain t877a mutant in complex with hydroxyflutamide
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d2ax6a1:

Sequence, based on SEQRES records: (download)

>d2ax6a1 a.123.1.1 (A:672-917) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfh

Sequence, based on observed residues (ATOM records): (download)

>d2ax6a1 a.123.1.1 (A:672-917) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiaptscsrrf
yqltklldsvqpiarelhqfafdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyf
h

SCOP Domain Coordinates for d2ax6a1:

Click to download the PDB-style file with coordinates for d2ax6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ax6a1: