Lineage for d2ax3a1 (2ax3 A:212-489)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2511964Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins)
    automatically mapped to Pfam PF01256
  6. 2511965Protein Hypothetical protein TM0922, C-terminal domain [142707] (1 species)
    YjeF homolog
  7. 2511966Species Thermotoga maritima [TaxId:2336] [142708] (21 PDB entries)
    Uniprot Q9X024 212-489
  8. 2511987Domain d2ax3a1: 2ax3 A:212-489 [127477]
    Other proteins in same PDB: d2ax3a2, d2ax3a3
    complexed with gol

Details for d2ax3a1

PDB Entry: 2ax3 (more details), 2.27 Å

PDB Description: crystal structure of a putative carbohydrate kinase (tm0922) from thermotoga maritima msb8 at 2.25 a resolution
PDB Compounds: (A:) hypothetical protein TM0922

SCOPe Domain Sequences for d2ax3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ax3a1 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
tremvrsllperprdshkgtygkvliiagsrlysgapvlsgmgslkvgtglvklavpfpq
nliatsrfpelisvpidtekgffslqnlqeclelskdvdvvaigpglgnnehvrefvnef
lktlekpavidadainvldtsvlkerkspavltphpgemarlvkktvgdvkynyelaeef
akendcvlvlksattivtdgektlfnitgntglskggsgdvltgmiagfiaqglspleas
tvsvylhgfaaelfeqdergltasellrlipeairrlk

SCOPe Domain Coordinates for d2ax3a1:

Click to download the PDB-style file with coordinates for d2ax3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ax3a1: