Lineage for d2awod1 (2awo D:236-371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791072Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2791092Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2791093Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2791121Domain d2awod1: 2awo D:236-371 [127473]
    Other proteins in same PDB: d2awoa2, d2awoa3, d2awob2, d2awob3, d2awoc2, d2awoc3, d2awod2, d2awod3
    automated match to d1q12a1
    complexed with adp, mg

Details for d2awod1

PDB Entry: 2awo (more details), 2.8 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ADP-Mg)
PDB Compounds: (D:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2awod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awod1 b.40.6.3 (D:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d2awod1:

Click to download the PDB-style file with coordinates for d2awod1.
(The format of our PDB-style files is described here.)

Timeline for d2awod1: