Lineage for d2awoc2 (2awo C:2-235)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848535Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1848652Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 1848653Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 1848680Domain d2awoc2: 2awo C:2-235 [127472]
    Other proteins in same PDB: d2awoa1, d2awob1, d2awoc1, d2awod1
    automated match to d1q12a2
    complexed with adp, mg

Details for d2awoc2

PDB Entry: 2awo (more details), 2.8 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ADP-Mg)
PDB Compounds: (C:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2awoc2:

Sequence, based on SEQRES records: (download)

>d2awoc2 c.37.1.12 (C:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Sequence, based on observed residues (ATOM records): (download)

>d2awoc2 c.37.1.12 (C:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfigekrmn
dtppaergvgmvalyphlsvaenmsfglklagakkevinqrvnqvaevlqlahlldrkpk
alsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrlgrtmiyvth
dqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d2awoc2:

Click to download the PDB-style file with coordinates for d2awoc2.
(The format of our PDB-style files is described here.)

Timeline for d2awoc2: