SCOPe 2.01: Domain d2awoc1: 2awo C:236-370

Lineage for d2awoc1 (2awo C:236-370)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.6: MOP-like [50331] (3 families)
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
probably stems out from the biMOP domain
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
Species Escherichia coli [TaxId:562] [101772] (6 PDB entries)
Domain d2awoc1: 2awo C:236-370 [127471]
Other proteins in same PDB: d2awoa2, d2awob2, d2awoc2, d2awod2
automatically matched to d1q12a1
complexed with adp, mg

Details for d2awoc1

PDB Entry: 2awo (more details), 2.8 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ADP-Mg)

PDB Compounds: (C:) Maltose/maltodextrin import ATP-binding protein malK

SCOPe Domain Sequences for d2awoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awoc1 b.40.6.3 (C:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOPe Domain Coordinates for d2awoc1:

Click to download the PDB-style file with coordinates for d2awoc1.
(The format of our PDB-style files is described here.)

Timeline for d2awoc1: