Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
Species Escherichia coli [TaxId:562] [102380] (15 PDB entries) |
Domain d2awob2: 2awo B:2-235 [127470] Other proteins in same PDB: d2awoa1, d2awoa3, d2awob1, d2awob3, d2awoc1, d2awoc3, d2awod1, d2awod3 automated match to d1q12a2 complexed with adp, mg |
PDB Entry: 2awo (more details), 2.8 Å
SCOPe Domain Sequences for d2awob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awob2 c.37.1.12 (B:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig
Timeline for d2awob2: