Lineage for d2awnc2 (2awn C:4-235)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697205Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 697305Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 697309Species Escherichia coli [TaxId:562] [102380] (5 PDB entries)
  8. 697312Domain d2awnc2: 2awn C:4-235 [127464]
    Other proteins in same PDB: d2awna1, d2awnb1, d2awnc1, d2awnd1
    automatically matched to d1q12a2
    complexed with adp, mg

Details for d2awnc2

PDB Entry: 2awn (more details), 2.3 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ATP-Mg)
PDB Compounds: (C:) Maltose/maltodextrin import ATP-binding protein malK

SCOP Domain Sequences for d2awnc2:

Sequence, based on SEQRES records: (download)

>d2awnc2 c.37.1.12 (C:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig
ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql
ahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrl
grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Sequence, based on observed residues (ATOM records): (download)

>d2awnc2 c.37.1.12 (C:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
vqlqnvtvskdinldihegefvvfvgpsgcgkstllrmiaglgvgmvfqsyalyphlsva
enmsfglklagakkevinqrvnqvaevlqlahlldrkpkalsggqrqrvaigrtlvaeps
vflldeplsnldaalrvqmrieisrlhkrlgrtmiyvthdqveamtladkivvldagrva
qvgkplelyhypadrfvagfig

SCOP Domain Coordinates for d2awnc2:

Click to download the PDB-style file with coordinates for d2awnc2.
(The format of our PDB-style files is described here.)

Timeline for d2awnc2: