Lineage for d2awnc1 (2awn C:236-370)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668809Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 668893Family b.40.6.3: ABC-transporter additional domain [50338] (3 proteins)
    probably stems out from the biMOP domain
  6. 668913Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 668919Species Escherichia coli [TaxId:562] [101772] (5 PDB entries)
  8. 668922Domain d2awnc1: 2awn C:236-370 [127463]
    Other proteins in same PDB: d2awna2, d2awnb2, d2awnc2, d2awnd2
    automatically matched to d1q12a1
    complexed with adp, mg

Details for d2awnc1

PDB Entry: 2awn (more details), 2.3 Å

PDB Description: Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ATP-Mg)
PDB Compounds: (C:) Maltose/maltodextrin import ATP-binding protein malK

SCOP Domain Sequences for d2awnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awnc1 b.40.6.3 (C:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOP Domain Coordinates for d2awnc1:

Click to download the PDB-style file with coordinates for d2awnc1.
(The format of our PDB-style files is described here.)

Timeline for d2awnc1: