![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
![]() | Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [102380] (6 PDB entries) |
![]() | Domain d2awna2: 2awn A:4-235 [127460] Other proteins in same PDB: d2awna1, d2awnb1, d2awnc1, d2awnd1 automatically matched to d1q12a2 complexed with adp, mg |
PDB Entry: 2awn (more details), 2.3 Å
SCOPe Domain Sequences for d2awna2:
Sequence, based on SEQRES records: (download)
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql ahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrl grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig ekrmndtppaergvgmvfqsyalevinqrvnqvaevlaigrtlvaepsvflldeplsnld aalrvqmrieisrlhkrlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhyp adrfvagfig
Timeline for d2awna2: