Lineage for d2awig2 (2awi G:71-301)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647383Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)
  6. 647384Protein PrgX [140849] (1 species)
  7. 647385Species Enterococcus faecalis [TaxId:1351] [140850] (6 PDB entries)
  8. 647392Domain d2awig2: 2awi G:71-301 [127448]
    Other proteins in same PDB: d2awia1, d2awib1, d2awic1, d2awid1, d2awie1, d2awif1, d2awig1, d2awih1, d2awii1, d2awij1, d2awik1, d2awil1
    automatically matched to 2AWI A:71-301
    mutant

Details for d2awig2

PDB Entry: 2awi (more details), 2.25 Å

PDB Description: Structure of PrgX Y153C mutant
PDB Compounds: (G:) PrgX

SCOP Domain Sequences for d2awig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awig2 a.118.8.4 (G:71-301) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen

SCOP Domain Coordinates for d2awig2:

Click to download the PDB-style file with coordinates for d2awig2.
(The format of our PDB-style files is described here.)

Timeline for d2awig2: