Lineage for d2awid1 (2awi D:3-66)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268438Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1268439Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1268440Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1268444Domain d2awid1: 2awi D:3-66 [127441]
    Other proteins in same PDB: d2awia2, d2awib2, d2awic2, d2awid2, d2awie2, d2awif2, d2awig2, d2awih2, d2awii2, d2awij2, d2awik2, d2awil2
    automated match to d2awia1
    mutant

Details for d2awid1

PDB Entry: 2awi (more details), 2.25 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (D:) PrgX

SCOPe Domain Sequences for d2awid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awid1 a.35.1.11 (D:3-66) PrgX {Enterococcus faecalis [TaxId: 1351]}
kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil
nrag

SCOPe Domain Coordinates for d2awid1:

Click to download the PDB-style file with coordinates for d2awid1.
(The format of our PDB-style files is described here.)

Timeline for d2awid1: