Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries) Uniprot Q04114 1-69! Uniprot Q04114 2-66 |
Domain d2awid1: 2awi D:3-66 [127441] Other proteins in same PDB: d2awia2, d2awib2, d2awic2, d2awid2, d2awie2, d2awif2, d2awig2, d2awih2, d2awii2, d2awij2, d2awik2, d2awil2 automatically matched to 2AWI A:2-66 mutant |
PDB Entry: 2awi (more details), 2.25 Å
SCOP Domain Sequences for d2awid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awid1 a.35.1.11 (D:3-66) PrgX {Enterococcus faecalis [TaxId: 1351]} kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil nrag
Timeline for d2awid1: