Lineage for d2awia2 (2awi A:71-301)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775887Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)
  6. 775888Protein PrgX [140849] (1 species)
  7. 775889Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 775890Domain d2awia2: 2awi A:71-301 [127436]
    Other proteins in same PDB: d2awia1, d2awib1, d2awic1, d2awid1, d2awie1, d2awif1, d2awig1, d2awih1, d2awii1, d2awij1, d2awik1, d2awil1
    mutant

Details for d2awia2

PDB Entry: 2awi (more details), 2.25 Å

PDB Description: Structure of PrgX Y153C mutant
PDB Compounds: (A:) PrgX

SCOP Domain Sequences for d2awia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awia2 a.118.8.4 (A:71-301) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyen

SCOP Domain Coordinates for d2awia2:

Click to download the PDB-style file with coordinates for d2awia2.
(The format of our PDB-style files is described here.)

Timeline for d2awia2: