Lineage for d2awha1 (2awh A:211-476)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776879Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 776880Species Human (Homo sapiens) [TaxId:9606] [48527] (11 PDB entries)
  8. 776883Domain d2awha1: 2awh A:211-476 [127433]
    automatically matched to d2gwxb_
    complexed with b7g, vca

Details for d2awha1

PDB Entry: 2awh (more details), 2 Å

PDB Description: Human Nuclear Receptor-Ligand Complex 1
PDB Compounds: (A:) Peroxisome proliferator activated receptor delta

SCOP Domain Sequences for d2awha1:

Sequence, based on SEQRES records: (download)

>d2awha1 a.123.1.1 (A:211-476) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvng
lppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifaml
asivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaa
iilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteha
qmmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d2awha1 a.123.1.1 (A:211-476) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
lkafskhiynaylknfnmtkkkarsilthtapfvihdietlwqaekglvwkeisvhvfyr
cqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvang
sgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvp
rveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetets
lhpllqeiykdm

SCOP Domain Coordinates for d2awha1:

Click to download the PDB-style file with coordinates for d2awha1.
(The format of our PDB-style files is described here.)

Timeline for d2awha1: