Lineage for d2awha_ (2awh A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48527] (37 PDB entries)
  8. Domain d2awha_: 2awh A: [127433]
    automated match to d1gwxa_
    complexed with b7g, vca

Details for d2awha_

PDB Entry: 2awh (more details), 2 Å

PDB Description: human nuclear receptor-ligand complex 1
PDB Compounds: (A:) Peroxisome proliferator activated receptor delta

SCOPe Domain Sequences for d2awha_:

Sequence, based on SEQRES records: (download)

>d2awha_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
dlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvn
glppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifam
lasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfia
aiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvteh
aqmmqrikktetetslhpllqeiykdmy

Sequence, based on observed residues (ATOM records): (download)

>d2awha_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
dlkafskhiynaylknfnmtkkkarsilthtapfvihdietlwqaekglvwkeisvhvfy
rcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvan
gsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnv
prveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqrikktetet
slhpllqeiykdmy

SCOPe Domain Coordinates for d2awha_ are not available.

Timeline for d2awha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2awhb_