SCOPe 2.08: Domain d2awfa1: 2awf A:8-131

Lineage for d2awfa1 (2awf A:8-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), E2 G1 [TaxId:9606] [143056] (1 PDB entry)
   Uniprot P62253 7-131

8. Domain d2awfa1: 2awf A:8-131 [127432]
   Other proteins in same PDB: d2awfa2

Details for d2awfa1

PDB Entry: 2awf, 2.1 Å

PDB Description: Structure of human Ubiquitin-conjugating enzyme E2 G1

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 G1

SCOPe Domain Sequences for d2awfa1:

Sequence, based on SEQRES records:

>d2awfa1 d.20.1.1 (A:8-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]}
lllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahltfpkdypl
rppkmkfiteiwhpnvdkngdvcisilhepgedkygyekpeerwlpihtvetimisvism
ladp

Sequence, based on observed residues (ATOM records):

>d2awfa1 d.20.1.1 (A:8-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]}
lllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahltfpkdypl
rppkmkfiteiwhpnvdkngdvcisilheppeerwlpihtvetimisvismladp

Timeline for d2awfa1:

• d2awfa1 first appeared in SCOP 1.73
  
• d2awfa1 appears in SCOPe 2.07