Lineage for d2awfa1 (2awf A:8-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939031Species Human (Homo sapiens), E2 G1 [TaxId:9606] [143056] (1 PDB entry)
    Uniprot P62253 7-131
  8. 2939032Domain d2awfa1: 2awf A:8-131 [127432]
    Other proteins in same PDB: d2awfa2

Details for d2awfa1

PDB Entry: 2awf (more details), 2.1 Å

PDB Description: Structure of human Ubiquitin-conjugating enzyme E2 G1
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 G1

SCOPe Domain Sequences for d2awfa1:

Sequence, based on SEQRES records: (download)

>d2awfa1 d.20.1.1 (A:8-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]}
lllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahltfpkdypl
rppkmkfiteiwhpnvdkngdvcisilhepgedkygyekpeerwlpihtvetimisvism
ladp

Sequence, based on observed residues (ATOM records): (download)

>d2awfa1 d.20.1.1 (A:8-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]}
lllrrqlaelnknpvegfsagliddndlyrwevliigppdtlyeggvfkahltfpkdypl
rppkmkfiteiwhpnvdkngdvcisilheppeerwlpihtvetimisvismladp

SCOPe Domain Coordinates for d2awfa1:

Click to download the PDB-style file with coordinates for d2awfa1.
(The format of our PDB-style files is described here.)

Timeline for d2awfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2awfa2