SCOPe 2.08: Domain d2awdb2: 2awd B:2-312

Lineage for d2awdb2 (2awd B:2-312)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [186955] (2 PDB entries)

8. Domain d2awdb2: 2awd B:2-312 [127431]
   Other proteins in same PDB: d2awda1, d2awda2, d2awda3, d2awdb3
   automated match to d1o14a_
   complexed with br

Details for d2awdb2

PDB Entry: 2awd, 2 Å

PDB Description: crystal structure of lacc from enterococcus faecalis

PDB Compounds: (B:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2awdb2:

Sequence; same for both SEQRES and ATOM records:

>d2awdb2 c.72.1.0 (B:2-312) automated matches {Enterococcus faecalis [TaxId: 1351]}
ivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlgg
fhgafianelkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflenf
dqlikqaeivtisgslakglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpyl
ikpnleelegllgqdfsenplaavqtaltkpmfagiewivislgkdgaiakhhdqfyrvk
iptiqaknpvgsgdatiaglayglakdapaaellkwgmaagmanaqermtghvdvenvkk
hlmniqvveia

Timeline for d2awdb2:

• d2awdb2 first appeared in SCOP 1.73, called d2awdb1
  
• d2awdb2 appears in SCOPe 2.07