Lineage for d2awda1 (2awd A:2-313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904327Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2904452Protein Tagatose-6-phosphate kinase LacC [142710] (1 species)
  7. 2904453Species Enterococcus faecalis [TaxId:1351] [142711] (1 PDB entry)
    Uniprot Q833W9 1-313
  8. 2904454Domain d2awda1: 2awd A:2-313 [127430]
    Other proteins in same PDB: d2awda2, d2awda3, d2awdb2, d2awdb3
    complexed with br

Details for d2awda1

PDB Entry: 2awd (more details), 2 Å

PDB Description: crystal structure of lacc from enterococcus faecalis
PDB Compounds: (A:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2awda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awda1 c.72.1.1 (A:2-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]}
ivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlgg
fhgafianelkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflenf
dqlikqaeivtisgslakglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpyl
ikpnleelegllgqdfsenplaavqtaltkpmfagiewivislgkdgaiakhhdqfyrvk
iptiqaknpvgsgdatiaglayglakdapaaellkwgmaagmanaqermtghvdvenvkk
hlmniqvveiak

SCOPe Domain Coordinates for d2awda1:

Click to download the PDB-style file with coordinates for d2awda1.
(The format of our PDB-style files is described here.)

Timeline for d2awda1: