SCOPe 2.08: Domain d2awda1: 2awd A:2-313

Lineage for d2awda1 (2awd A:2-313)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
   automatically mapped to Pfam PF00294

6. Protein Tagatose-6-phosphate kinase LacC [142710] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [142711] (1 PDB entry)
   Uniprot Q833W9 1-313

8. Domain d2awda1: 2awd A:2-313 [127430]
   Other proteins in same PDB: d2awda2, d2awda3, d2awdb2, d2awdb3
   complexed with br

Details for d2awda1

PDB Entry: 2awd, 2 Å

PDB Description: crystal structure of lacc from enterococcus faecalis

PDB Compounds: (A:) tagatose-6-phosphate kinase

SCOPe Domain Sequences for d2awda1:

Sequence; same for both SEQRES and ATOM records:

>d2awda1 c.72.1.1 (A:2-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]}
ivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlgg
fhgafianelkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflenf
dqlikqaeivtisgslakglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpyl
ikpnleelegllgqdfsenplaavqtaltkpmfagiewivislgkdgaiakhhdqfyrvk
iptiqaknpvgsgdatiaglayglakdapaaellkwgmaagmanaqermtghvdvenvkk
hlmniqvveiak

Timeline for d2awda1:

• d2awda1 first appeared in SCOP 1.73
  
• d2awda1 appears in SCOPe 2.07