Lineage for d2awbz1 (2awb Z:1-70)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616787Fold d.325: L28p-like [143799] (1 superfamily)
    unusual fold consisting of three beta-hairpins, that form a paper clip-like structure, and two helices; could have evolved from a glucocorticoid receptor-like zinc finger domain (57715)
  4. 2616788Superfamily d.325.1: L28p-like [143800] (2 families) (S)
    In early ribosomal structures, L28p has been misinterpreted as L31p. in the Ribosomal protein L28p family, there are sequences containing two CxxC pairs. Threading these sequences into this fold brings the four cysteines in a similar site to the zinc-binding site of glucocorticoid receptor-like zinc fingers. In the Ribosomal protein L31p, there are also members with two CxxC pairs. However, these won't form a putative zinc-binding site in this fold. The L31p family are classified here temporarily, until its true fold is known
  5. 2616821Family d.325.1.2: Ribosomal protein L31p [143804] (1 protein)
    Pfam PF01197
  6. 2616822Protein Ribosomal protein L31p [143805] (2 species)
  7. 2616823Species Escherichia coli [TaxId:562] [143806] (9 PDB entries)
    Uniprot P0A7M9 1-70
  8. 2616826Domain d2awbz1: 2awb Z:1-70 [127429]
    Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbc1, d2awbc2, d2awbd1, d2awbe1, d2awbf1, d2awbg1, d2awbg2, d2awbh1, d2awbh2, d2awbi1, d2awbi2, d2awbj1, d2awbk1, d2awbl1, d2awbm1, d2awbn1, d2awbo1, d2awbp1, d2awbq1, d2awbr1, d2awbs1, d2awbt1, d2awbu1, d2awbv1, d2awbw1, d2awbx1, d2awby1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2awbz1

PDB Entry: 2awb (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli at 3.5 A resolution. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (Z:) 50S ribosomal protein L31

SCOPe Domain Sequences for d2awbz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awbz1 d.325.1.2 (Z:1-70) Ribosomal protein L31p {Escherichia coli [TaxId: 562]}
mkkdihpkyeeitascscgnvmkirstvghdlnldvcskchpfftgkqrdvatggrvdrf
nkrfnipgsk

SCOPe Domain Coordinates for d2awbz1:

Click to download the PDB-style file with coordinates for d2awbz1.
(The format of our PDB-style files is described here.)

Timeline for d2awbz1: