Class b: All beta proteins [48724] (165 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein L25 [50717] (1 species) |
Species Escherichia coli [TaxId:562] [50718] (12 PDB entries) |
Domain d2awbv1: 2awb V:1-94 [127427] Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbl1, d2awbm1, d2awbp1, d2awbr1, d2awbu1, d2awbx1, d2awbz1 automatically matched to d1b75a_ complexed with mg |
PDB Entry: 2awb (more details), 3.46 Å
SCOP Domain Sequences for d2awbv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awbv1 b.53.1.1 (V:1-94) Ribosomal protein L25 {Escherichia coli [TaxId: 562]} mftinaevrkeqgkgasrrlraankfpaiiyggkeaplaieldhdkvmnmqakaefysev ltivvdgkeikvkaqdvqrhpykpklqhidfvra
Timeline for d2awbv1: