![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141094] (7 PDB entries) |
![]() | Domain d2awbr1: 2awb R:1-103 [127425] Other proteins in same PDB: d2awb01, d2awb11, d2awb21, d2awb31, d2awb41, d2awbl1, d2awbm1, d2awbp1, d2awbu1, d2awbv1, d2awbx1, d2awbz1 automatically matched to 2AW4 R:1-103 complexed with mg |
PDB Entry: 2awb (more details), 3.46 Å
SCOP Domain Sequences for d2awbr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awbr1 b.155.1.1 (R:1-103) Ribosomal protein L21p {Escherichia coli [TaxId: 562]} myavfqsggkqhrvsegqtvrlekldiatgetvefaevlmiangeevkigvpfvdggvik aevvahgrgekvkivkfrrrkhyrkqqghrqwftdvkitgisa
Timeline for d2awbr1: