Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
Species Deinococcus radiodurans [TaxId:1299] [117896] (2 PDB entries) Uniprot Q9RUV2 |
Domain d2aw9b2: 2aw9 B:98-211 [127416] Other proteins in same PDB: d2aw9a1, d2aw9b1 automated match to d1y67a2 complexed with mn |
PDB Entry: 2aw9 (more details), 2.7 Å
SCOPe Domain Sequences for d2aw9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw9b2 d.44.1.1 (B:98-211) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} nqpsgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplm geaiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
Timeline for d2aw9b2: