![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [116763] (2 PDB entries) Uniprot Q9RUV2 |
![]() | Domain d2aw9b1: 2aw9 B:2-89 [127415] Other proteins in same PDB: d2aw9a2, d2aw9a3, d2aw9a4, d2aw9b2, d2aw9b3 automated match to d1y67a1 complexed with mn |
PDB Entry: 2aw9 (more details), 2.7 Å
SCOPe Domain Sequences for d2aw9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw9b1 a.2.11.1 (B:2-89) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld rvpadkkgalrnnagghanhsmfwqimg
Timeline for d2aw9b1:
![]() Domains from other chains: (mouse over for more information) d2aw9a1, d2aw9a2, d2aw9a3, d2aw9a4 |