![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [117896] (2 PDB entries) Uniprot Q9RUV2 |
![]() | Domain d2aw9a2: 2aw9 A:98-211 [127414] Other proteins in same PDB: d2aw9a1, d2aw9a3, d2aw9a4, d2aw9b1, d2aw9b3 automated match to d1y67a2 complexed with mn |
PDB Entry: 2aw9 (more details), 2.7 Å
SCOPe Domain Sequences for d2aw9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw9a2 d.44.1.1 (A:98-211) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} nqpsgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplm geaiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak
Timeline for d2aw9a2: