Lineage for d2aw6b1 (2aw6 B:1-66)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1996135Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1996136Protein automated matches [190907] (10 species)
    not a true protein
  7. 1996188Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. 1996189Domain d2aw6b1: 2aw6 B:1-66 [127410]
    Other proteins in same PDB: d2aw6a1, d2aw6a2, d2aw6b2
    automated match to d2awia1
    protein/DNA complex

Details for d2aw6b1

PDB Entry: 2aw6 (more details), 3 Å

PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2aw6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw6b1 a.35.1.0 (B:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnrag

SCOPe Domain Coordinates for d2aw6b1:

Click to download the PDB-style file with coordinates for d2aw6b1.
(The format of our PDB-style files is described here.)

Timeline for d2aw6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aw6b2