![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
![]() | Protein automated matches [190907] (10 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries) |
![]() | Domain d2aw6b1: 2aw6 B:1-66 [127410] Other proteins in same PDB: d2aw6a1, d2aw6a2, d2aw6b2 automated match to d2awia1 protein/DNA complex |
PDB Entry: 2aw6 (more details), 3 Å
SCOPe Domain Sequences for d2aw6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw6b1 a.35.1.0 (B:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]} mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe ilnrag
Timeline for d2aw6b1: