Lineage for d2aw6b1 (2aw6 B:1-69)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768002Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 768003Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 768300Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 768301Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 768302Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 768332Domain d2aw6b1: 2aw6 B:1-69 [127410]
    Other proteins in same PDB: d2aw6a2, d2aw6b2
    automatically matched to 2AW6 A:1-69

Details for d2aw6b1

PDB Entry: 2aw6 (more details), 3 Å

PDB Description: structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
PDB Compounds: (B:) PrgX

SCOP Domain Sequences for d2aw6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw6b1 a.35.1.11 (B:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

SCOP Domain Coordinates for d2aw6b1:

Click to download the PDB-style file with coordinates for d2aw6b1.
(The format of our PDB-style files is described here.)

Timeline for d2aw6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aw6b2