![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
![]() | Protein Ribosomal protein L19 [141246] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141247] (9 PDB entries) |
![]() | Domain d2aw4p1: 2aw4 P:1-114 [127402] Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4l1, d2aw4m1, d2aw4r1, d2aw4u1, d2aw4v1, d2aw4x1, d2aw4z1 complexed with mg |
PDB Entry: 2aw4 (more details), 3.46 Å
SCOP Domain Sequences for d2aw4p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw4p1 b.34.5.6 (P:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2aw4p1: