![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
![]() | Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
![]() | Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
![]() | Protein Ribosomal protein L15 (L15p) [52082] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [141994] (9 PDB entries) |
![]() | Domain d2aw4l1: 2aw4 L:1-144 [127400] Other proteins in same PDB: d2aw401, d2aw411, d2aw421, d2aw431, d2aw441, d2aw4m1, d2aw4p1, d2aw4r1, d2aw4u1, d2aw4v1, d2aw4x1, d2aw4z1 complexed with mg |
PDB Entry: 2aw4 (more details), 3.46 Å
SCOP Domain Sequences for d2aw4l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw4l1 c.12.1.1 (L:1-144) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} mrlntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrr lpkfgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpv tvrglrvtkgaraaieaaggkiee
Timeline for d2aw4l1: