Lineage for d2aw3a1 (2aw3 A:1-796)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709765Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 709766Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (9 families) (S)
  5. 709818Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 709947Protein Maltodextrin phosphorylase (MALP) [53771] (1 species)
  7. 709948Species Escherichia coli [TaxId:562] [53772] (11 PDB entries)
  8. 709959Domain d2aw3a1: 2aw3 A:1-796 [127393]
    automatically matched to d1l5va_
    complexed with glc, plp, so4

Details for d2aw3a1

PDB Entry: 2aw3 (more details), 2.2 Å

PDB Description: X-Ray studies on maltodextrin phosphorylase complexes: recognition of substrates and cathalitic mechanism of phosphorylase family
PDB Compounds: (A:) maltodextrin phosphorylase

SCOP Domain Sequences for d2aw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw3a1 c.87.1.4 (A:1-796) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]}
sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
drsirdyqariwqakr

SCOP Domain Coordinates for d2aw3a1:

Click to download the PDB-style file with coordinates for d2aw3a1.
(The format of our PDB-style files is described here.)

Timeline for d2aw3a1: