Lineage for d2aw3a_ (2aw3 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 proteins)
    automatically mapped to Pfam PF00343
  6. Protein automated matches [190111] (3 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [186953] (4 PDB entries)
  8. Domain d2aw3a_: 2aw3 A: [127393]
    automated match to d1ahpa_
    complexed with plp, so4

Details for d2aw3a_

PDB Entry: 2aw3 (more details), 2.2 Å

PDB Description: x-ray studies on maltodextrin phosphorylase complexes: recognition of substrates and cathalitic mechanism of phosphorylase family
PDB Compounds: (A:) maltodextrin phosphorylase

SCOPe Domain Sequences for d2aw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw3a_ c.87.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
drsirdyqariwqakr

SCOPe Domain Coordinates for d2aw3a_ are not available.

Timeline for d2aw3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aw3b_