| Class g: Small proteins [56992] (98 folds) |
| Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
| Family g.24.1.1: TNF receptor-like [57587] (6 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
| Protein Cellular receptor HveA [64568] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries) |
| Domain d2aw2y2: 2aw2 Y:60-103 [127392] Other proteins in same PDB: d2aw2a1, d2aw2a2, d2aw2x2, d2aw2x3 automated match to d1jmab2 complexed with ni |
PDB Entry: 2aw2 (more details), 2.8 Å
SCOPe Domain Sequences for d2aw2y2:
Sequence, based on SEQRES records: (download)
>d2aw2y2 g.24.1.1 (Y:60-103) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacray
>d2aw2y2 g.24.1.1 (Y:60-103) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdhcaacray
Timeline for d2aw2y2: