Lineage for d2aw2y2 (2aw2 Y:60-103)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891719Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 891720Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 891721Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 891722Protein Cellular receptor HveA [64568] (1 species)
  7. 891723Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries)
  8. 891729Domain d2aw2y2: 2aw2 Y:60-103 [127392]
    Other proteins in same PDB: d2aw2a1, d2aw2x1
    automatically matched to d1jmab2
    complexed with ful, nag, ni

Details for d2aw2y2

PDB Entry: 2aw2 (more details), 2.8 Å

PDB Description: crystal structure of the human btla-hvem complex
PDB Compounds: (Y:) Tumor necrosis factor receptor superfamily member 14

SCOP Domain Sequences for d2aw2y2:

Sequence, based on SEQRES records: (download)

>d2aw2y2 g.24.1.1 (Y:60-103) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacray

Sequence, based on observed residues (ATOM records): (download)

>d2aw2y2 g.24.1.1 (Y:60-103) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdhcaacray

SCOP Domain Coordinates for d2aw2y2:

Click to download the PDB-style file with coordinates for d2aw2y2.
(The format of our PDB-style files is described here.)

Timeline for d2aw2y2: