Class g: Small proteins [56992] (98 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.1: TNF receptor-like [57587] (6 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
Protein Cellular receptor HveA [64568] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries) |
Domain d2aw2y1: 2aw2 Y:2-59 [127391] Other proteins in same PDB: d2aw2a1, d2aw2a2, d2aw2x2, d2aw2x3 automated match to d1jmab1 complexed with ni |
PDB Entry: 2aw2 (more details), 2.8 Å
SCOPe Domain Sequences for d2aw2y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw2y1 g.24.1.1 (Y:2-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]} psckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq
Timeline for d2aw2y1: