Lineage for d2aw2y1 (2aw2 Y:2-59)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639375Protein Cellular receptor HveA [64568] (1 species)
  7. 2639376Species Human (Homo sapiens) [TaxId:9606] [64569] (2 PDB entries)
  8. 2639381Domain d2aw2y1: 2aw2 Y:2-59 [127391]
    Other proteins in same PDB: d2aw2a1, d2aw2a2, d2aw2x2, d2aw2x3
    automated match to d1jmab1
    complexed with ni

Details for d2aw2y1

PDB Entry: 2aw2 (more details), 2.8 Å

PDB Description: crystal structure of the human btla-hvem complex
PDB Compounds: (Y:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d2aw2y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw2y1 g.24.1.1 (Y:2-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}
psckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

SCOPe Domain Coordinates for d2aw2y1:

Click to download the PDB-style file with coordinates for d2aw2y1.
(The format of our PDB-style files is described here.)

Timeline for d2aw2y1: