SCOPe 2.08: Domain d2aw2b2: 2aw2 B:60-103

Lineage for d2aw2b2 (2aw2 B:60-103)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
   Pfam PF00020; TNFR/NGFR cysteine-rich region

6. Protein Cellular receptor HveA, C-terminal domain [419059] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [419550] (2 PDB entries)

8. Domain d2aw2b2: 2aw2 B:60-103 [127390]
   Other proteins in same PDB: d2aw2a1, d2aw2a2, d2aw2b1, d2aw2x2, d2aw2x3, d2aw2y1
   automated match to d1jmab2
   complexed with ni

Details for d2aw2b2

PDB Entry: 2aw2, 2.8 Å

PDB Description: crystal structure of the human btla-hvem complex

PDB Compounds: (B:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d2aw2b2:

Sequence, based on SEQRES records:

>d2aw2b2 g.24.1.1 (B:60-103) Cellular receptor HveA, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdgdhcaacray

Sequence, based on observed residues (ATOM records):

>d2aw2b2 g.24.1.1 (B:60-103) Cellular receptor HveA, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mcdpamglrasrncsrtenavcgcspghfcivqdhcaacray

Timeline for d2aw2b2:

• d2aw2b2 first appeared in SCOP 1.73
  
• d2aw2b2 appears in SCOPe 2.07