Lineage for d2avud1 (2avu D:3-78)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778996Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
    multihelical; forms intertwined dimer of identical 5-helical subunits
  4. 778997Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) (S)
  5. 778998Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
    contains an HTH motif
  6. 778999Protein Flagellar transcriptional activator FlhD [63594] (1 species)
  7. 779000Species Escherichia coli [TaxId:562] [63595] (2 PDB entries)
  8. 779006Domain d2avud1: 2avu D:3-78 [127386]
    Other proteins in same PDB: d2avue1, d2avuf1
    automatically matched to d1g8eb_
    complexed with zn

Details for d2avud1

PDB Entry: 2avu (more details), 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription
PDB Compounds: (D:) Transcriptional activator flhD

SCOP Domain Sequences for d2avud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avud1 a.145.1.1 (D:3-78) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitql

SCOP Domain Coordinates for d2avud1:

Click to download the PDB-style file with coordinates for d2avud1.
(The format of our PDB-style files is described here.)

Timeline for d2avud1: