![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily) multihelical; forms intertwined dimer of identical 5-helical subunits |
![]() | Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) ![]() |
![]() | Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein) contains an HTH motif |
![]() | Protein Flagellar transcriptional activator FlhD [63594] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63595] (2 PDB entries) |
![]() | Domain d2avuc1: 2avu C:3-78 [127385] Other proteins in same PDB: d2avue1, d2avuf1 automatically matched to d1g8eb_ complexed with zn |
PDB Entry: 2avu (more details), 3 Å
SCOP Domain Sequences for d2avuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avuc1 a.145.1.1 (C:3-78) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]} tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq lvchfrfdshqtitql
Timeline for d2avuc1: