SCOP 1.75: Domain d2avuc1: 2avu C:3-78

Lineage for d2avuc1 (2avu C:3-78)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
   multihelical; forms intertwined dimer of identical 5-helical subunits

4. Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family)

5. Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
   contains an HTH motif

6. Protein Flagellar transcriptional activator FlhD [63594] (1 species)

7. Species Escherichia coli [TaxId:562] [63595] (2 PDB entries)

8. Domain d2avuc1: 2avu C:3-78 [127385]
   Other proteins in same PDB: d2avue1, d2avuf1
   automatically matched to d1g8eb_
   complexed with zn

Details for d2avuc1

PDB Entry: 2avu, 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription

PDB Compounds: (C:) Transcriptional activator flhD

SCOP Domain Sequences for d2avuc1:

Sequence; same for both SEQRES and ATOM records:

>d2avuc1 a.145.1.1 (C:3-78) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitql

Timeline for d2avuc1:

• d2avuc1 first appeared in SCOP 1.73
  
• d2avuc1 appears in SCOPe 2.01
  
• d2avuc1 appears in the current release, SCOPe 2.08, called d2avuc_