Class a: All alpha proteins [46456] (290 folds) |
Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily) multihelical; forms intertwined dimer of identical 5-helical subunits |
Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) |
Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein) contains an HTH motif |
Protein Flagellar transcriptional activator FlhD [63594] (1 species) |
Species Escherichia coli [TaxId:562] [63595] (3 PDB entries) |
Domain d2avuc_: 2avu C: [127385] Other proteins in same PDB: d2avue1, d2avuf_ automated match to d1g8ea_ complexed with zn |
PDB Entry: 2avu (more details), 3 Å
SCOPe Domain Sequences for d2avuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avuc_ a.145.1.1 (C:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]} tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq lvchfrfdshqtitql
Timeline for d2avuc_: