Lineage for d2avuc_ (2avu C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340555Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
    multihelical; forms intertwined dimer of identical 5-helical subunits
  4. 2340556Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) (S)
  5. 2340557Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
    contains an HTH motif
  6. 2340558Protein Flagellar transcriptional activator FlhD [63594] (1 species)
  7. 2340559Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)
  8. 2340564Domain d2avuc_: 2avu C: [127385]
    Other proteins in same PDB: d2avue1, d2avuf_
    automated match to d1g8ea_
    complexed with zn

Details for d2avuc_

PDB Entry: 2avu (more details), 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription
PDB Compounds: (C:) Transcriptional activator flhD

SCOPe Domain Sequences for d2avuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avuc_ a.145.1.1 (C:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitql

SCOPe Domain Coordinates for d2avuc_:

Click to download the PDB-style file with coordinates for d2avuc_.
(The format of our PDB-style files is described here.)

Timeline for d2avuc_: