SCOPe 2.05: Domain d2avua_: 2avu A:

Lineage for d2avua_ (2avu A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
   multihelical; forms intertwined dimer of identical 5-helical subunits

4. Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family)

5. Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
   contains an HTH motif

6. Protein Flagellar transcriptional activator FlhD [63594] (1 species)

7. Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)

8. Domain d2avua_: 2avu A: [127383]
   Other proteins in same PDB: d2avue1, d2avuf_
   automated match to d1g8ea_
   complexed with zn

Details for d2avua_

PDB Entry: 2avu, 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription

PDB Compounds: (A:) Transcriptional activator flhD

SCOPe Domain Sequences for d2avua_:

Sequence; same for both SEQRES and ATOM records:

>d2avua_ a.145.1.1 (A:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitql

Timeline for d2avua_:

• d2avua_ first appeared in SCOP 1.73, called d2avua1
  
• d2avua_ appears in SCOPe 2.04
  
• d2avua_ appears in SCOPe 2.06
  
• d2avua_ appears in the current release, SCOPe 2.08