SCOP 1.73: Domain d2avua1: 2avu A:3-78

Lineage for d2avua1 (2avu A:3-78)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
   multihelical; forms intertwined dimer of identical 5-helical subunits

4. Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family)

5. Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
   contains an HTH motif

6. Protein Flagellar transcriptional activator FlhD [63594] (1 species)

7. Species Escherichia coli [TaxId:562] [63595] (2 PDB entries)

8. Domain d2avua1: 2avu A:3-78 [127383]
   automatically matched to d1g8eb_
   complexed with zn

Details for d2avua1

PDB Entry: 2avu, 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription

PDB Compounds: (A:) Transcriptional activator flhD

SCOP Domain Sequences for d2avua1:

Sequence; same for both SEQRES and ATOM records:

>d2avua1 a.145.1.1 (A:3-78) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitql

Timeline for d2avua1:

• d2avua1 is new in SCOP 1.73
  
• d2avua1 appears in SCOP 1.75
  
• d2avua1 appears in the current release, SCOPe 2.08, called d2avua_